Structure of PDB 1rpq Chain A Binding Site BS01

Receptor Information
>1rpq Chain A (length=165) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPKVSLNPPWNRIFKGENVTLTCNGNNVSSTKWFHNGSLSEETNSSLNIV
NAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLR
CHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVW
QLDYESEPLNITVIK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1rpq Convergent Recognition of the IgE Binding Site on the High-Affinity IgE Receptor.
Resolution3.0 Å
Binding residue
(original residue number in PDB)
S85 D86 W87 W110 R111 W156 L158 Y160
Binding residue
(residue number reindexed from 1)
S79 D80 W81 W104 R105 W150 L152 Y154
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1rpq, PDBe:1rpq, PDBj:1rpq
PDBsum1rpq
PubMed15242605
UniProtP12319|FCERA_HUMAN High affinity immunoglobulin epsilon receptor subunit alpha (Gene Name=FCER1A)

[Back to BioLiP]