Structure of PDB 1rnb Chain A Binding Site BS01

Receptor Information

>1rnb Chain A (length=109) Species: 1390 (Bacillus amyloliquefaciens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QVINTFDGVADYLQTYHKLPNDYITKSEAQALGWVASKGNLADVAPGKSI
GGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTD
HYQTFTKIR

Ligand information

>1rnb Chain C (length=2) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1rnb Crystal structure of a barnase-d(GpC) complex at 1.9 A resolution.
Resolution	1.9 Å
Binding residue (original residue number in PDB)	R83 N84 S85 R87 H102
Binding residue (residue number reindexed from 1)	R82 N83 S84 R86 H101

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0004521	RNA endonuclease activity
GO:0004540	RNA nuclease activity

View graph for
Molecular Function

External links

PDB	RCSB:1rnb, PDBe:1rnb, PDBj:1rnb
PDBsum	1rnb
PubMed	2023257
UniProt	P00648\|RNBR_BACAM Ribonuclease

[Back to BioLiP]