Structure of PDB 1rmv Chain A Binding Site BS01

Receptor Information

>1rmv Chain A (length=156) Species: 51680 (Ribgrass mosaic virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SYNITNSNQYQYFAAVWAEPTPMLNQCVSALSQSYQTQAGRDTVRQQFAN
LLSTIVAPNQRFPDTGFRVYVNSAVIKPLYEALMKSFDTRNRIIETEEES
RPSASEVANATQRVDDATVAIRSQIQLLLNELSNGHGYMNRAEFEAILPW
TTAPAT

Ligand information

>1rmv Chain B (length=3) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gaa

...

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1rmv Molecular dynamics in refinement against fiber diffraction data.
Resolution	2.9 Å
Binding residue (original residue number in PDB)	D115 D116 V119 R122 S123 L127
Binding residue (residue number reindexed from 1)	D115 D116 V119 R122 S123 L127

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005198	structural molecule activity

	Cellular Component
GO:0019028	viral capsid
GO:0019029	helical viral capsid

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:1rmv, PDBe:1rmv, PDBj:1rmv
PDBsum	1rmv
PubMed	8129880
UniProt	P03580\|CAPSD_RMVHR Capsid protein (Gene Name=CP)

[Back to BioLiP]