Structure of PDB 1rkc Chain A Binding Site BS01

Receptor Information
>1rkc Chain A (length=258) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAA
VSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPY
SVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEV
VETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKE
LLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQL
TSWDEDAW
Ligand information
>1rkc Chain B (length=26) Species: 9031 (Gallus gallus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YTKKELIESARKVSEKVSHVLAALQA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1rkc Vinculin activation by talin through helical bundle conversion
Resolution2.7 Å
Binding residue
(original residue number in PDB)		S11 I12 V16 Q19 I20 L23 P43 A46 V47 A50 L54 V57 T61 R105 S112 F126 K133
Binding residue
(residue number reindexed from 1)		S11 I12 V16 Q19 I20 L23 P43 A46 V47 A50 L54 V57 T61 R105 S112 F126 K133
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0005198 structural molecule activity
GO:0051015 actin filament binding
Biological Process
GO:0007155 cell adhesion
Cellular Component
GO:0015629 actin cytoskeleton

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1rkc, PDBe:1rkc, PDBj:1rkc
PDBsum1rkc
PubMed14702644
UniProtP18206|VINC_HUMAN Vinculin (Gene Name=VCL)

[Back to BioLiP]