Structure of PDB 1rgo Chain A Binding Site BS01

Receptor Information
>1rgo Chain A (length=70) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STRYKTELCRPFEESGTCKYGEKCQFAHGFHELRSLTRHPKYKTELCRTF
HTIGFCPYGPRCHFIHNADE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1rgo Recognition of the mRNA AU-rich element by the zinc finger domain of TIS11d.
ResolutionN/A
Binding residue
(original residue number in PDB)		R153 K155 T156 E157 L158 R160 K169 Y170 K173 C174 Q175 F176 H189 K191 K193 T194 E195 L196 R198 Y208 R211 C212 H213 F214
Binding residue
(residue number reindexed from 1)		R3 K5 T6 E7 L8 R10 K19 Y20 K23 C24 Q25 F26 H39 K41 K43 T44 E45 L46 R48 Y58 R61 C62 H63 F64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:1rgo, PDBe:1rgo, PDBj:1rgo
PDBsum1rgo
PubMed14981510
UniProtP47974|TISD_HUMAN mRNA decay activator protein ZFP36L2 (Gene Name=ZFP36L2)

[Back to BioLiP]