Structure of PDB 1rf3 Chain A Binding Site BS01

Receptor Information

>1rf3 Chain A (length=192) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYK
RRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFV
IMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTG
EMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSDLPDP

Ligand information

>1rf3 Chain B (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PYPIPEEGDPGPPGLSTPHQEDGK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1rf3 Structurally distinct recognition motifs in lymphotoxin-beta receptor and CD40 for tumor necrosis factor receptor-associated factor (TRAF)-mediated signaling.
Resolution	3.5 Å
Binding residue (original residue number in PDB)	R393 D399 M401 F410 F448 D451 S456 I466 A467 G469 P471 V472
Binding residue (residue number reindexed from 1)	R81 D87 M89 F98 F136 D139 S144 I154 A155 G157 P159 V160

Enzymatic activity

Enzyme Commision number

2.3.2.27: RING-type E3 ubiquitin transferase.

Gene Ontology

	Molecular Function
GO:0005164	tumor necrosis factor receptor binding

	Biological Process
GO:0001817	regulation of cytokine production
GO:0008063	Toll signaling pathway
GO:0032088	negative regulation of NF-kappaB transcription factor activity
GO:0033209	tumor necrosis factor-mediated signaling pathway
GO:0045087	innate immune response
GO:0050688	regulation of defense response to virus

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1rf3, PDBe:1rf3, PDBj:1rf3
PDBsum	1rf3
PubMed	14517219
UniProt	Q13114\|TRAF3_HUMAN TNF receptor-associated factor 3 (Gene Name=TRAF3)

[Back to BioLiP]