Structure of PDB 1rb4 Chain A Binding Site BS01

Receptor Information
>1rb4 Chain A (length=30) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RMKQLEDKVEELLSKAYHLENEVARLKKLV
Ligand information
>1rb4 Chain C (length=29) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RMKQLEDKVEELLSKAYHLENEVARLKKL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1rb4 Automated protein crystal structure determination using ELVES.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		M2 V9 E10 Y17 L19 E20 V23 L26 K27
Binding residue
(residue number reindexed from 1)		M2 V9 E10 Y17 L19 E20 V23 L26 K27
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1rb4, PDBe:1rb4, PDBj:1rb4
PDBsum1rb4
PubMed14752198
UniProtP03069|GCN4_YEAST General control transcription factor GCN4 (Gene Name=GCN4)

[Back to BioLiP]