Structure of PDB 1r9f Chain A Binding Site BS01

Receptor Information
>1r9f Chain A (length=121) Species: 12145 (Tomato bushy stunt virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMTSPFKLPDESPSWTEWRLHNDETQDNPLGFKESWGFGKVVFKRYLRYD
RTEASLHRVLGSWTGDSVNYAASRFFGFDQIGCTYSIRFRGVSITVSGGS
RTLQHLCEMAIRSKQEMLQMA
Ligand information
>1r9f Chain B (length=20) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cguacgcggaauacuucgau
....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1r9f Recognition of small interfering RNA by a viral suppressor of RNA
Resolution1.85 Å
Binding residue
(original residue number in PDB)		P37 W39 W42 K60 Q107 I108 G109 S124 G125 G126
Binding residue
(residue number reindexed from 1)		P13 W15 W18 K33 Q80 I81 G82 S97 G98 G99
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0044423 virion component

View graph for
Cellular Component
External links
PDB RCSB:1r9f, PDBe:1r9f, PDBj:1r9f
PDBsum1r9f
PubMed14661029
UniProtP11690|P19_TBSVC RNA silencing suppressor p19 (Gene Name=ORF4)

[Back to BioLiP]