Structure of PDB 1r8d Chain A Binding Site BS01

Receptor Information
>1r8d Chain A (length=109) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKYQVKQVAEISGVSIRTLHHYDNIELLNPSALTDAGYRLYSDADLERLQ
QILFFKEIGFRLDEIKEMLDHPNFDRKAALQSQKEILMKKKQRMDEMIQT
IDRTLLSVD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1r8d The structural mechanism for transcription activation by MerR family member multidrug transporter activation, N terminus.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		V5 K6 R17 H20 Y38 R39
Binding residue
(residue number reindexed from 1)		V5 K6 R17 H20 Y38 R39
Binding affinityPDBbind-CN: Kd=96nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1r8d, PDBe:1r8d, PDBj:1r8d
PDBsum1r8d
PubMed14985361
UniProtP71039|MTA_BACSU HTH-type transcriptional activator mta (Gene Name=mta)

[Back to BioLiP]