Structure of PDB 1r1s Chain A Binding Site BS01

Receptor Information
>1r1s Chain A (length=96) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIEFPEWFHEGLSRHQAENLLMGKDIGFFIIRASQSSPGDFSISVRHEDD
VQHFKVMRDTKGNYFLWTEKFPSLNKLVDYYRTTSISKQKQVFLRD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1r1s Structural basis for differential recognition of tyrosine-phosphorylated sites in the linker for activation of T cells (LAT) by the adaptor Gads.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		R67 R85 S87 Q88 S89 S95 H106 F107 K108 M110 L119 W120
Binding residue
(residue number reindexed from 1)		R14 R32 S34 Q35 S36 S42 H53 F54 K55 M57 L66 W67
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1r1s, PDBe:1r1s, PDBj:1r1s
PDBsum1r1s
PubMed15029250
UniProtO89100|GRAP2_MOUSE GRB2-related adaptor protein 2 (Gene Name=Grap2)

[Back to BioLiP]