Structure of PDB 1r1q Chain A Binding Site BS01

Receptor Information
>1r1q Chain A (length=97) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IDIEFPEWFHEGLSRHQAENLLMGKDIGFFIIRASQSSPGDFSISVRHED
DVQHFKVMRDTKGNYFLWTEKFPSLNKLVDYYRTTSISKQKQVFLRD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1r1q Structural basis for differential recognition of tyrosine-phosphorylated sites in the linker for activation of T cells (LAT) by the adaptor Gads.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		R67 R85 S87 Q88 S89 S95 Q105 H106 F107 K108 L119 W120
Binding residue
(residue number reindexed from 1)		R15 R33 S35 Q36 S37 S43 Q53 H54 F55 K56 L67 W68
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1r1q, PDBe:1r1q, PDBj:1r1q
PDBsum1r1q
PubMed15029250
UniProtO89100|GRAP2_MOUSE GRB2-related adaptor protein 2 (Gene Name=Grap2)

[Back to BioLiP]