Structure of PDB 1qwf Chain A Binding Site BS01

Receptor Information
>1qwf Chain A (length=56) Species: 11876 (Avian sarcoma virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPS
NYVAPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1qwf Specific interactions outside the proline-rich core of two classes of Src homology 3 ligands.
ResolutionN/A
Binding residue
(original residue number in PDB)		Y14 T22 D23 E39 G40 D41 W42 Y55 P57 S58 N59 Y60
Binding residue
(residue number reindexed from 1)		Y6 T14 D15 E31 G32 D33 W34 Y47 P49 S50 N51 Y52
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
Gene Ontology
Biological Process
GO:0006897 endocytosis
GO:0051666 actin cortical patch localization

View graph for
Biological Process
External links
PDB RCSB:1qwf, PDBe:1qwf, PDBj:1qwf
PDBsum1qwf
PubMed8618911
UniProtP00525|SRC_AVISR Tyrosine-protein kinase transforming protein Src (Gene Name=V-SRC)

[Back to BioLiP]