Structure of PDB 1qs7 Chain A Binding Site BS01

Receptor Information
>1qs7 Chain A (length=145) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMIN
EVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAA
ELRHVMTNLGEKLTDEEVDEMIREADVDGDGQVNYEEFVQVMMAK
Ligand information
>1qs7 Chain B (length=19) Species: 9031 (Gallus gallus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RRKWQKTGHAVRAIGRLSS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1qs7 Target Enzyme Recognition by Calmodulin: 2.4 A Structure of a Calmodulin- Peptide Complex
Resolution1.8 Å
Binding residue
(original residue number in PDB)		E11 F12 E14 A15 F19 M51 L71 M72 R74 M76 E84 A88 V91 F92 L105 M109 K115 E120 M124 F141 M145 A147 K148
Binding residue
(residue number reindexed from 1)		E8 F9 E11 A12 F16 M48 L68 M69 R71 M73 E81 A85 V88 F89 L102 M106 K112 E117 M121 F138 M142 A144 K145
Enzymatic activity
Catalytic site (original residue number in PDB) V35
Catalytic site (residue number reindexed from 1) V32
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:1qs7, PDBe:1qs7, PDBj:1qs7
PDBsum1qs7
PubMed
UniProtA0MMD0

[Back to BioLiP]