Structure of PDB 1qrv Chain A Binding Site BS01

Receptor Information
>1qrv Chain A (length=73) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDKPKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKSE
WEAKAAKAKDDYDRAVKEFEANG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1qrv The structure of a chromosomal high mobility group protein-DNA complex reveals sequence-neutral mechanisms important for non-sequence-specific DNA recognition.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		K4 R7 Y12 M13 T33 A36 W43 R44 E71
Binding residue
(residue number reindexed from 1)		K3 R6 Y11 M12 T32 A35 W42 R43 E70
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1qrv, PDBe:1qrv, PDBj:1qrv
PDBsum1qrv
PubMed10581235
UniProtQ05783|HMGD_DROME High mobility group protein D (Gene Name=HmgD)

[Back to BioLiP]