Structure of PDB 1qri Chain A Binding Site BS01

Receptor Information
>1qri Chain A (length=261) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SQGVIGIFGDYAKAHDLAVGEVSKLVKKALSNEYPQLSFRYRDSIKKTEI
NEALKKIDPDLGGTLFVSNSSIKPDGGIVEVKDDYGEWRVVLVAEAKHQG
KDIINIRNGLLVGKRGDQDLMAAGNAIDRSHKNISEIANFMLSESHFPYV
LFLEGSNFLTENISITRPDGRVVNLEYNSGILNRLDRLTAANYGMPINSN
LCINKFVNHKDKSIMLQAASIYTQGDGREWDSKIMFEIMFDISTTSLRVL
GRDLFEQLTSK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1qri X-Ray Structure of the DNA-Eco RI Endonuclease Complexes with the ED144 and RK145 Mutations
Resolution2.6 Å
Binding residue
(original residue number in PDB)		V83 N85 S86 S87 I88 K89 D91 H114 Q115 K130 M137 A138 G140 N141 A142 R145
Binding residue
(residue number reindexed from 1)		V67 N69 S70 S71 I72 K73 D75 H98 Q99 K114 M121 A122 G124 N125 A126 R129
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1qri, PDBe:1qri, PDBj:1qri
PDBsum1qri
PubMed
UniProtP00642|T2E1_ECOLX Type II restriction enzyme EcoRI (Gene Name=ecoRIR)

[Back to BioLiP]