Structure of PDB 1qpi Chain A Binding Site BS01

Receptor Information
>1qpi Chain A (length=195) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLD
ALAVEILARHHDYSLPAAGESWQSFLRNNAMSFRRALLRYRDGAKVHLGT
RPDEKQYDTVETQLRFMTENGFSLRDGLYAISAVSHFTLGAVLEQQEHTA
ALENLPPLLREALQIMDSDDGEQAFLHGLESLIRGFEVQLTALLQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1qpi Structural basis of gene regulation by the tetracycline inducible Tet repressor-operator system.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		E37 P39 T40 W43
Binding residue
(residue number reindexed from 1)		E34 P36 T37 W40
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0046677 response to antibiotic

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1qpi, PDBe:1qpi, PDBj:1qpi
PDBsum1qpi
PubMed10700280
UniProtP0ACT4|TETR4_ECOLX Tetracycline repressor protein class D (Gene Name=tetR)

[Back to BioLiP]