Structure of PDB 1qnh Chain A Binding Site BS01

Receptor Information
>1qnh Chain A (length=169) Species: 5833 (Plasmodium falciparum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRSKVFFDISIDNSNAGRIIFELFSDITPRTCENFRALCTGEKIGSRGKN
LHYKNSIFHRIIPQFMCQGGDITNGNGSGGESIYGRSFTDENFNMKHDQP
GLLSMANAGPNTNSSQFLITLVPCPWLDGKHVVFGKVIEGMNVVREMEKE
GAKSGYVKRSVVITDCGEW
Ligand information
>1qnh Chain C (length=11) Species: 29910 (Tolypocladium inflatum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ALLVTAGLVLA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1qnh The Three-Dimensional Structure of a Plasmodium Falciparum Cyclophilin in Complex with the Potent Anti-Malarial Cyclosporin A
Resolution2.1 Å
Binding residue
(original residue number in PDB)		R62 F67 M68 Q70 G79 A108 N109 Q118 L120 W128 H133
Binding residue
(residue number reindexed from 1)		R60 F65 M66 Q68 G77 A106 N107 Q116 L118 W126 H131
Enzymatic activity
Catalytic site (original residue number in PDB) R62 F67 Q70 N109 L120 L129 H133
Catalytic site (residue number reindexed from 1) R60 F65 Q68 N107 L118 L127 H131
Enzyme Commision number 5.2.1.8: peptidylprolyl isomerase.
Gene Ontology
Molecular Function
GO:0003755 peptidyl-prolyl cis-trans isomerase activity
Biological Process
GO:0000413 protein peptidyl-prolyl isomerization
GO:0006457 protein folding

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1qnh, PDBe:1qnh, PDBj:1qnh
PDBsum1qnh
PubMed10756109
UniProtQ25756

[Back to BioLiP]