Structure of PDB 1qng Chain A Binding Site BS01

Receptor Information
>1qng Chain A (length=170) Species: 5833 (Plasmodium falciparum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKRSKVFFDISIDNSNAGRIIFELFSDITPRTCENFRALCTGEKIGSRGK
NLHYKNSIFHRIIPQFMCQGGDITNGNGSGGESIYGRSFTDENFNMKHDQ
PGLLSMANAGPNTNSSQFFITLVPCPWLDGKHVVFGKVIEGMNVVREMEK
EGAKSGYVKRSVVITDCGEL
Ligand information
>1qng Chain D (length=11) Species: 29910 (Tolypocladium inflatum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ALLVTAGLVLA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1qng The Three-Dimensional Structure of a Plasmodium Falciparum Cyclophilin in Complex with the Potent Anti-Malarial Cyclosporin A
Resolution2.1 Å
Binding residue
(original residue number in PDB)		R62 F67 M68 Q70 G79 A108 N109 Q118 F120 W128 H133
Binding residue
(residue number reindexed from 1)		R61 F66 M67 Q69 G78 A107 N108 Q117 F119 W127 H132
Enzymatic activity
Catalytic site (original residue number in PDB) R62 F67 Q70 N109 F120 L129 H133
Catalytic site (residue number reindexed from 1) R61 F66 Q69 N108 F119 L128 H132
Enzyme Commision number 5.2.1.8: peptidylprolyl isomerase.
Gene Ontology
Molecular Function
GO:0003755 peptidyl-prolyl cis-trans isomerase activity
Biological Process
GO:0000413 protein peptidyl-prolyl isomerization
GO:0006457 protein folding

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1qng, PDBe:1qng, PDBj:1qng
PDBsum1qng
PubMed10756109
UniProtQ25756

[Back to BioLiP]