Structure of PDB 1qnb Chain A Binding Site BS01

Receptor Information

>1qnb Chain A (length=183) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIR
EPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKI
QNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIF
VSGKIVITGAKMRDETYKAFENIYPVLSEFRKI

Ligand information

>1qnb Chain C (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gctataaatgggca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1qnb TATA Element Recognition by the TATA Box-Binding Protein Has Been Conserved Throughout Evolution
Resolution	2.23 Å
Binding residue (original residue number in PDB)	V29 T31 A58 F74 S76 K78 V80 Q116 N117 F148 R154 T173
Binding residue (residue number reindexed from 1)	V14 T16 A43 F59 S61 K63 V65 Q101 N102 F133 R139 T158

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding

	Biological Process
GO:0006352	DNA-templated transcription initiation

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1qnb, PDBe:1qnb, PDBj:1qnb
PDBsum	1qnb
PubMed	10617571
UniProt	P28147\|TBP1_ARATH TATA-box-binding protein 1 (Gene Name=TBP1)

[Back to BioLiP]