Structure of PDB 1qls Chain A Binding Site BS01

Receptor Information
>1qls Chain A (length=95) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTETERCIESLIAIFQKHAGRDGNNTKISKTEFLIFMNTELAAFTQNQKD
PGVLDRMMKKLDLDSDGQLDFQEFLNLIGGLAIACHDSFIKSTQK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1qls Structural Basis of the Ca2+ Dependent Association between S100C (S100A11) and its Target, the N-Terminal Part of Annexin I
Resolution2.3 Å
Binding residue
(original residue number in PDB)		A47 F48 N51 Q52 A88 C89 S92
Binding residue
(residue number reindexed from 1)		A43 F44 N47 Q48 A84 C85 S88
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0044548 S100 protein binding
GO:0046872 metal ion binding
GO:0048306 calcium-dependent protein binding
Biological Process
GO:0042127 regulation of cell population proliferation
Cellular Component
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1qls, PDBe:1qls, PDBj:1qls
PDBsum1qls
PubMed10673436
UniProtP31950|S10AB_PIG Protein S100-A11 (Gene Name=S100A11)

[Back to BioLiP]