Structure of PDB 1qjj Chain A Binding Site BS01

Receptor Information
>1qjj Chain A (length=200) Species: 6715 (Astacus astacus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AAILGDEYLWSGGVIPYTFAGVSGADQSAILSGMQELEEKTCIRFVPRTT
ESDYVEIFTSGSGCWSYVGRISGAQQVSLQANGCVYHGTIIHELMHAIGF
YHEHTRMDRDNYVTINYQNVDPSMTSNFDIDTYSRYVGEDYQYYSIMHYG
KYSFSIQWGVLETIVPLQNGIDLTDPYDKAHMLQTDANQINNLYTNECSL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1qjj Structure of Astacin with a Transition-State Analogue Inhibitor
Resolution1.86 Å
Binding residue
(original residue number in PDB)		W65 S66 Y67 H96 H102 Y149
Binding residue
(residue number reindexed from 1)		W65 S66 Y67 H96 H102 Y149
Enzymatic activity
Catalytic site (original residue number in PDB) H92 E93 H96 H102 Y149
Catalytic site (residue number reindexed from 1) H92 E93 H96 H102 Y149
Enzyme Commision number 3.4.24.21: astacin.
Gene Ontology
Molecular Function
GO:0004222 metalloendopeptidase activity
GO:0008237 metallopeptidase activity
GO:0008270 zinc ion binding
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1qjj, PDBe:1qjj, PDBj:1qjj
PDBsum1qjj
PubMed8756323
UniProtP07584|ASTA_ASTAS Astacin

[Back to BioLiP]