Structure of PDB 1qgc Chain A Binding Site BS01

Receptor Information
>1qgc Chain A (length=220) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVMLVESGGGLVKPGGSLKLSCTASGFIFNRCAMSWVRQTPEKRLEWVAT
ISSGGTYTYYPDSVKGRFTISRDNAKNTLYLQMSSLRSADTAMYYCVRRE
DGGDEGFAYWGQGTVVTVSAAKTTPPSVYPLAPGSAAAAASMVTLGCLVK
GYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETV
TCNVAHPASSTKVDKKIVPR
Ligand information
>1qgc Chain 5 (length=24) Species: 12116 (Foot and mouth disease virus C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TTAYTASARGDLAHLTTTAARTLP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1qgc Structure of the complex of an Fab fragment of a neutralizing antibody with foot-and-mouth disease virus: positioning of a highly mobile antigenic loop.
Resolution30.0 Å
Binding residue
(original residue number in PDB)		T50 Y57 Y59 R99 E100 G102 G103
Binding residue
(residue number reindexed from 1)		T50 Y57 Y59 R99 E100 G102 G103
External links