Structure of PDB 1q5l Chain A Binding Site BS01

Receptor Information
>1q5l Chain A (length=115) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQ
GERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKN
SGKEQKITIKASSGL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1q5l The solution structure of the bacterial HSP70 chaperone protein domain DnaK(393-507) in complex with the peptide NRLLLTG.
ResolutionN/A
Binding residue
(original residue number in PDB)		T403 M404 G405 T409 S427 T428 A429 T437
Binding residue
(residue number reindexed from 1)		T11 M12 G13 T17 S35 T36 A37 T45
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005524 ATP binding
GO:0140662 ATP-dependent protein folding chaperone

View graph for
Molecular Function
External links
PDB RCSB:1q5l, PDBe:1q5l, PDBj:1q5l
PDBsum1q5l
PubMed14573869
UniProtP0A6Y8|DNAK_ECOLI Chaperone protein DnaK (Gene Name=dnaK)

[Back to BioLiP]