Structure of PDB 1q3l Chain A Binding Site BS01

Receptor Information
>1q3l Chain A (length=52) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EYAVEKIIDRRVRKGMVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEA
SR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1q3l Chromodomain Of HP1 Complexed With Histone H3 Tail Containing monomethyllysine 9
Resolution1.64 Å
Binding residue
(original residue number in PDB)
E23 Y24 V26 W45 Y48 E56 N60 D62 C63 L66
Binding residue
(residue number reindexed from 1)
E1 Y2 V4 W23 Y26 E34 N38 D40 C41 L44
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1q3l, PDBe:1q3l, PDBj:1q3l
PDBsum1q3l
PubMed
UniProtP05205|HP1_DROME Heterochromatin protein 1 (Gene Name=Su(var)205)

[Back to BioLiP]