Structure of PDB 1q3f Chain A Binding Site BS01

Receptor Information
>1q3f Chain A (length=223) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEFFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQM
CDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDI
EDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVS
WLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGC
RHFSKTNELLQKSGKKPIDWKEL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1q3f Electrostatic guidance of glycosyl cation migration along the reaction coordinate of uracil DNA glycosylase.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		D145 P146 P168 S169 G246 S247 H268 S270 P271 L272 S273 R276
Binding residue
(residue number reindexed from 1)		D64 P65 P87 S88 G165 S166 H187 S189 P190 L191 S192 R195
Enzymatic activity
Enzyme Commision number 3.2.2.27: uracil-DNA glycosylase.
Gene Ontology
Molecular Function
GO:0004844 uracil DNA N-glycosylase activity
GO:0016799 hydrolase activity, hydrolyzing N-glycosyl compounds
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1q3f, PDBe:1q3f, PDBj:1q3f
PDBsum1q3f
PubMed14580190
UniProtP13051|UNG_HUMAN Uracil-DNA glycosylase (Gene Name=UNG)

[Back to BioLiP]