Structure of PDB 1q2c Chain A Binding Site BS01

Receptor Information
>1q2c Chain A (length=162) Species: 5911 (Tetrahymena thermophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMV
ILKNKQKVIGGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDH
MQKQNIEYLLTYADNFAIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLM
ECYIHPYVDYGR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1q2c Structural basis for histone and phosphohistone binding by the GCN5 histone acetyltransferase
Resolution2.25 Å
Binding residue
(original residue number in PDB)		M80 V123 A124 F125 L126 T159 Y160 D162 N163 F164 A165 F169
Binding residue
(residue number reindexed from 1)		M32 V75 A76 F77 L78 T111 Y112 D114 N115 F116 A117 F121
Enzymatic activity
Catalytic site (original residue number in PDB) Y115 F120 E122 V123 A124 L126 L158 I189 Y192
Catalytic site (residue number reindexed from 1) Y67 F72 E74 V75 A76 L78 L110 I141 Y144
Enzyme Commision number 2.3.1.48: histone acetyltransferase.
Gene Ontology
Molecular Function
GO:0004402 histone acetyltransferase activity
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups

View graph for
Molecular Function
External links
PDB RCSB:1q2c, PDBe:1q2c, PDBj:1q2c
PDBsum1q2c
PubMed14536085
UniProtQ27198

[Back to BioLiP]