Structure of PDB 1pzy Chain A Binding Site BS01

Receptor Information

>1pzy Chain A (length=123) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TELTKCKVSHAIKDIDGYQGISLLEWACVLFHTSGYDTQAVVNDNGSTEY
GLFQISDRFWCKSSEFPESENICGISCDKLLDDELDDDIACAKKILAIKG
IDYWKAYKPMCSEKLEQWRCEKP

Ligand information

InChI=1S/Ca/q+2

BHPQYMZQTOCNFJ-UHFFFAOYSA-N

SMILES

Software	SMILES
CACTVS 3.341	[Ca++]
ACDLabs 10.04 OpenEye OEToolkits 1.5.0	[Ca+2]

Formula

Ca

Name

CALCIUM ION

PDB chain

1pzy Chain A Residue 403 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1pzy The Role of Tryptophan 314 in the Conformational Changes of beta 1,4-Galactosyltransferase-I
Resolution	2.3 Å
Binding residue (original residue number in PDB)	K79 D82 E84 D87 D88
Binding residue (residue number reindexed from 1)	K79 D82 E84 D87 D88
Annotation score	1

Enzymatic activity

Catalytic site (original residue number in PDB)	T33 N45 S47 E49 S56
Catalytic site (residue number reindexed from 1)	T33 N45 S47 E49 S56
Enzyme Commision number	?

Gene Ontology

	Molecular Function
GO:0004461	lactose synthase activity
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0046872	metal ion binding

	Biological Process
GO:0005989	lactose biosynthetic process

	Cellular Component
GO:0005576	extracellular region
GO:0032991	protein-containing complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1pzy, PDBe:1pzy, PDBj:1pzy
PDBsum	1pzy
PubMed	12927542
UniProt	P29752\|LALBA_MOUSE Alpha-lactalbumin (Gene Name=Lalba)

[Back to BioLiP]