Structure of PDB 1pyi Chain A Binding Site BS01

Receptor Information
>1pyi Chain A (length=88) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRTACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLDPATGKDVPRSYVFF
LEDRLAVMMRVLKEYGVDPTKIRGNIPATSDDEPFDLK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1pyi Crystal structure of a PPR1-DNA complex: DNA recognition by proteins containing a Zn2Cys6 binuclear cluster.
Resolution3.2 Å
Binding residue
(original residue number in PDB)
K40 K41
Binding residue
(residue number reindexed from 1)
K11 K12
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:1pyi, PDBe:1pyi, PDBj:1pyi
PDBsum1pyi
PubMed7958913
UniProtP07272|PPR1_YEAST Pyrimidine pathway regulatory protein 1 (Gene Name=PPR1)

[Back to BioLiP]