Structure of PDB 1pvi Chain A Binding Site BS01

Receptor Information
>1pvi Chain A (length=156) Species: 585 (Proteus vulgaris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHPDLNKLLELWPHIQEYQDLALKHGINDIFQDNGGKLLQVLLITGLTVL
PGREGNDAVDNAGQEYELKSINIDLTKGFSTHHHMNPVIIAKYRQVPWIF
AIYRGIAIEAIYRLEPKDLEFYYDKWERKWYSDGHKDINNPKIPVKYVME
HGTKIY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1pvi Structure of PvuII endonuclease with cognate DNA.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
Q33 H84 K126 N140
Binding residue
(residue number reindexed from 1)
Q32 H83 K125 N139
Enzymatic activity
Catalytic site (original residue number in PDB) D58 E68 K70
Catalytic site (residue number reindexed from 1) D57 E67 K69
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:1pvi, PDBe:1pvi, PDBj:1pvi
PDBsum1pvi
PubMed8076590
UniProtP23657|T2P2_PROHU Type II restriction enzyme PvuII (Gene Name=pvuIIR)

[Back to BioLiP]