Structure of PDB 1pua Chain A Binding Site BS01

Receptor Information
>1pua Chain A (length=162) Species: 5911 (Tetrahymena thermophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMV
ILKNKQKVIGGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDH
MQKQNIEYLLTYADNFAIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLM
ECYIHPYVDYGR
Ligand information
>1pua Chain B (length=19) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QTARKSTGGKAPRKQLASK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1pua Structural basis for histone and phospho-histone binding by the GCN5 histone acetyltransferase
Resolution2.3 Å
Binding residue
(original residue number in PDB)		P78 K79 M80 Y84 K87 L88 H94 R113 Y115 E122 V123 A124 F125 L126 T159 Y160 D162 N163 F164 A165 F169 Y188 I189 K190 D191
Binding residue
(residue number reindexed from 1)		P30 K31 M32 Y36 K39 L40 H46 R65 Y67 E74 V75 A76 F77 L78 T111 Y112 D114 N115 F116 A117 F121 Y140 I141 K142 D143
Enzymatic activity
Catalytic site (original residue number in PDB) Y115 F120 E122 V123 A124 L126 L158 I189 Y192
Catalytic site (residue number reindexed from 1) Y67 F72 E74 V75 A76 L78 L110 I141 Y144
Enzyme Commision number 2.3.1.48: histone acetyltransferase.
Gene Ontology
Molecular Function
GO:0004402 histone acetyltransferase activity
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups

View graph for
Molecular Function
External links
PDB RCSB:1pua, PDBe:1pua, PDBj:1pua
PDBsum1pua
PubMed14536085
UniProtQ27198

[Back to BioLiP]