Structure of PDB 1pt3 Chain A Binding Site BS01

Receptor Information
>1pt3 Chain A (length=128) Species: 316407 (Escherichia coli str. K-12 substr. W3110) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPGKATGKGKPVNNKWLNNAGKDLGSPVPDRIANKLRDKEFKSFDDFRKK
FWEEVSKDPELSKQFSRNNNDRMKVGKAPKTRTQDVSGKRTSFELHHEKP
ISQNGGVYDMDNISVVTPKRHIDIHRGK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1pt3 DNA binding and degradation by the HNH protein ColE7.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R496 K525 A526 S540 E542 H569
Binding residue
(residue number reindexed from 1)		R48 K77 A78 S92 E94 H121
Enzymatic activity
Catalytic site (original residue number in PDB) R538 H544 H569 H573
Catalytic site (residue number reindexed from 1) R90 H96 H121 H125
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0005102 signaling receptor binding
Biological Process
GO:0009617 response to bacterium
GO:0019835 cytolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1pt3, PDBe:1pt3, PDBj:1pt3
PDBsum1pt3
PubMed14962381
UniProtQ47112|CEA7_ECOLX Colicin-E7 (Gene Name=colE7)

[Back to BioLiP]