Structure of PDB 1poh Chain A Binding Site BS01

Receptor Information

>1poh Chain A (length=85) Species: 562 (Escherichia coli)

MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKL
QTLGLTQGTVVTISAEGEDEQKAVEHLVKLMAELE

Ligand information

• Ligand ID: SO4
• InChI: InChI=1S/H2O4S/c1-5(2,3)4/h(H2,1,2,3,4)/p-2
• InChIKey: QAOWNCQODCNURD-UHFFFAOYSA-L
• SMILES:
  OpenEye OEToolkits 1.5.0: [O-]S(=O)(=O)[O-]
  CACTVS 3.341: [O-][S]([O-])(=O)=O
  ACDLabs 10.04: [O-]S([O-])(=O)=O
• Formula: O4 S
• Name: SULFATE ION
• DrugBank: DB14546
• PDB chain: 1poh Chain A Residue 91

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1poh The 2.0-A resolution structure of Escherichia coli histidine-containing phosphocarrier protein HPr. A redetermination.
• Resolution: 2.0 Å
• Binding residue (original residue number in PDB): N38 K40
• Binding residue (residue number reindexed from 1): N38 K40
• Annotation score: 3

Gene Ontology

Molecular Function

• GO:0004857 enzyme inhibitor activity
• GO:0005515 protein binding
• GO:0008047 enzyme activator activity
• GO:0016775 phosphotransferase activity, nitrogenous group as acceptor
• GO:0030234 enzyme regulator activity
• GO:0045152 antisigma factor binding

Biological Process

• GO:0009401 phosphoenolpyruvate-dependent sugar phosphotransferase system
• GO:0043609 regulation of carbon utilization
• GO:0045819 positive regulation of glycogen catabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:1poh, PDBe:1poh, PDBj:1poh
• PDBsum: 1poh
• PubMed: 8226757
• UniProt: P0AA04|PTHP_ECOLI Phosphocarrier protein HPr (Gene Name=ptsH)