Structure of PDB 1pmx Chain A Binding Site BS01

Receptor Information
>1pmx Chain A (length=70) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFR
SCDLRRLEMYCAPLKPAKSA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1pmx Complex with a Phage Display-Derived Peptide Provides Insight into the Function of Insulin-like Growth Factor I
ResolutionN/A
Binding residue
(original residue number in PDB)		E3 T4 E9 D12 A13 L54
Binding residue
(residue number reindexed from 1)		E3 T4 E9 D12 A13 L54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
GO:0008083 growth factor activity
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1pmx, PDBe:1pmx, PDBj:1pmx
PDBsum1pmx
PubMed12899619
UniProtP05019|IGF1_HUMAN Insulin-like growth factor I (Gene Name=IGF1)

[Back to BioLiP]