Structure of PDB 1pip Chain A Binding Site BS01

Receptor Information
>1pip Chain A (length=212) Species: 3649 (Carica papaya) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSE
QELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREK
GPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFV
GPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVC
GLYTSSFYPVKN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1pip Crystal structure of papain-succinyl-Gln-Val-Val-Ala-Ala-p-nitroanilide complex at 1.7-A resolution: noncovalent binding mode of a common sequence of endogenous thiol protease inhibitors.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		A136 A137 Q142 K156 V157 D158 W177
Binding residue
(residue number reindexed from 1)		A136 A137 Q142 K156 V157 D158 W177
Enzymatic activity
Catalytic site (original residue number in PDB) V16 Q19 C25 N155 H159 N175
Catalytic site (residue number reindexed from 1) V16 Q19 C25 N155 H159 N175
Enzyme Commision number 3.4.22.2: papain.
Gene Ontology
Molecular Function
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1pip, PDBe:1pip, PDBj:1pip
PDBsum1pip
PubMed1445868
UniProtP00784|PAPA1_CARPA Papain

[Back to BioLiP]