Structure of PDB 1pfb Chain A Binding Site BS01

Receptor Information
>1pfb Chain A (length=55) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLVYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLIDIY
EQTNK
Ligand information
>1pfb Chain B (length=11) Species: 7668 (Strongylocentrotus purpuratus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LATKAARKSAP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1pfb Structural basis for specific binding of Polycomb chromodomain to histone H3 methylated at Lys 27.
Resolution1.4 Å
Binding residue
(original residue number in PDB)		D23 L24 V25 Y26 A27 A28 W47 W50 E58 N62 D65 R67 L68
Binding residue
(residue number reindexed from 1)		D1 L2 V3 Y4 A5 A6 W25 W28 E36 N40 D43 R45 L46
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1pfb, PDBe:1pfb, PDBj:1pfb
PDBsum1pfb
PubMed12897052
UniProtP26017|PC_DROME Polycomb group protein Pc (Gene Name=Pc)

[Back to BioLiP]