Structure of PDB 1pd7 Chain A Binding Site BS01

Receptor Information
>1pd7 Chain A (length=85) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ESDSVEFNNAISYVNKIKTRFLDHPEIYRSFLEILHTYQKEQLHTKGRPF
RGMSEEEVFTEVANLFRGQEDLLSEFGQFLPEAKR
Ligand information
>1pd7 Chain B (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VRMNIQMLLEAADYLERREREAEH
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1pd7 Extension of the binding motif of the sin3 interacting domain of the mad family proteins(,).
ResolutionN/A
Binding residue
(original residue number in PDB)		E6 F7 I11 V14 N15 L35 H36 Y38 F76 Q78 F79
Binding residue
(residue number reindexed from 1)		E6 F7 I11 V14 N15 L35 H36 Y38 F76 Q78 F79
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003714 transcription corepressor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1pd7, PDBe:1pd7, PDBj:1pd7
PDBsum1pd7
PubMed14705930
UniProtQ62141|SIN3B_MOUSE Paired amphipathic helix protein Sin3b (Gene Name=Sin3b)

[Back to BioLiP]