Structure of PDB 1pau Chain A Binding Site BS01

Receptor Information
>1pau Chain A (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKY
EVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGP
VDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1pau The three-dimensional structure of apopain/CPP32, a key mediator of apoptosis.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R179 C285
Binding residue
(residue number reindexed from 1)		R31 C130
Enzymatic activity
Catalytic site (original residue number in PDB) T177 S178 H237 G238 C285 R286
Catalytic site (residue number reindexed from 1) T29 S30 H88 G89 C130 R131
Enzyme Commision number 3.4.22.56: caspase-3.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1pau, PDBe:1pau, PDBj:1pau
PDBsum1pau
PubMed8673606
UniProtP42574|CASP3_HUMAN Caspase-3 (Gene Name=CASP3)

[Back to BioLiP]