Structure of PDB 1p8d Chain A Binding Site BS01

Receptor Information
>1p8d Chain A (length=240) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLQSRDARQQRFAHF
TELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYN
HETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYA
LLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRM
LMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1p8d X-ray crystal structure of the liver X receptor beta ligand binding domain: regulation by a histidine-tryptophan switch.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		V283 K287 R297 I301 K305 P451 L452 E455
Binding residue
(residue number reindexed from 1)		V62 K66 R76 I80 K84 P230 L231 E234
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
Biological Process
GO:0006629 lipid metabolic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1p8d, PDBe:1p8d, PDBj:1p8d
PDBsum1p8d
PubMed12736258
UniProtP55055|NR1H2_HUMAN Oxysterols receptor LXR-beta (Gene Name=NR1H2)

[Back to BioLiP]