Structure of PDB 1p59 Chain A Binding Site BS01

Receptor Information

>1p59 Chain A (length=214) Species: 1422 (Geobacillus stearothermophilus)

MLTKQQIRYCLDEMAKMFPDAHCELVHRNPFELLIAVVLSAQCTDALVNK
VTKRLFEKYRTPHDYIAVPLEELEQDIRSIGLYRNKARNIQKLCAMLIDK
YNGEVPRDRDELMKLPGVGRKTANVVVSTAFGVPAIAVDTHVERVSKRLG
FCRWDDSVLEVEKTLMKIIPKEEWSITHHRMIFFGRYHCKAQSPQCPSCP
LLHLCREGKKRMRK

Ligand information

>1p59 Chain B (length=11)

aagacguggac

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1p59 Structure of a Trapped Endonuclease III-DNA Covalent Intermediate
• Resolution: 2.5 Å
• Binding residue (original residue number in PDB): Q42 L47 R78 S79 G81 L82 Y83 R84 N85
• Binding residue (residue number reindexed from 1): Q42 L47 R78 S79 G81 L82 Y83 R84 N85

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 30 23:13:29 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '1p59', asym_id = 'A', bs = 'BS01', title = 'Structure of a Trapped Endonuclease III-DNA Covalent Intermediate'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='1p59', asym_id='A', bs='BS01', title='Structure of a Trapped Endonuclease III-DNA Covalent Intermediate')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0003677,0003824,0003906,0006281,0006284,0051539', uniprot = '', pdbid = '1p59', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0003824,0003906,0006281,0006284,0051539', uniprot='', pdbid='1p59', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>