Structure of PDB 1p47 Chain A Binding Site BS01

Receptor Information
>1p47 Chain A (length=87) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLT
THIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1p47 Constraints for Zinc Finger Linker Design as Inferred from X-ray Crystal Structure of Tandem Zif268-DNA Complexes
Resolution2.2 Å
Binding residue
(original residue number in PDB)		R103 R114 F116 R118 E121 R124 H125 R142 F144 S145 R146 H149 H153 T156 R170 F172 R174 E177 R180 H181 I184
Binding residue
(residue number reindexed from 1)		R2 R13 F15 R17 E20 R23 H24 R41 F43 S44 R45 H48 H52 T55 R69 F71 R73 E76 R79 H80 I83
Binding affinityPDBbind-CN: Kd=2.1fM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1p47, PDBe:1p47, PDBj:1p47
PDBsum1p47
PubMed12818197
UniProtP08046|EGR1_MOUSE Early growth response protein 1 (Gene Name=Egr1)

[Back to BioLiP]