Structure of PDB 1ozs Chain A Binding Site BS01

Receptor Information
>1ozs Chain A (length=73) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKGKSEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMK
DGDKNNDGRIDYDEFLEFMKGVE
Ligand information
>1ozs Chain B (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TQKIFDLRGKFKRPTLRRVR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ozs Structure and dynamics of the C-domain of human cardiac troponin C in complex with the inhibitory region of human cardiac troponin I.
ResolutionN/A
Binding residue
(original residue number in PDB)		E96 L100 M120 T124 I128 V160
Binding residue
(residue number reindexed from 1)		E8 L12 M32 T36 I40 V72
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding

View graph for
Molecular Function
External links
PDB RCSB:1ozs, PDBe:1ozs, PDBj:1ozs
PDBsum1ozs
PubMed12732641
UniProtP63316|TNNC1_HUMAN Troponin C, slow skeletal and cardiac muscles (Gene Name=TNNC1)

[Back to BioLiP]