Structure of PDB 1ozj Chain A Binding Site BS01

Receptor Information
>1ozj Chain A (length=126) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAIT
TQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAM
ELCEFAFNMKKDEVCVNPYHYQRVET
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ozj Features of a Smad3 MH1-DNA complex. Roles of water and zinc in DNA binding.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		S70 L71 L75 Q76 S78 K81
Binding residue
(residue number reindexed from 1)		S64 L65 L69 Q70 S72 K75
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005667 transcription regulator complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ozj, PDBe:1ozj, PDBj:1ozj
PDBsum1ozj
PubMed12686552
UniProtP84022|SMAD3_HUMAN Mothers against decapentaplegic homolog 3 (Gene Name=SMAD3)

[Back to BioLiP]