Structure of PDB 1ozb Chain A Binding Site BS01

Receptor Information
>1ozb Chain A (length=144) Species: 727 (Haemophilus influenzae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVLQIQRIYVKDVSFEAPNLPHIFQQEWKPKLGFDLSTETTQVGDDLYEV
VLNISVETTLEDSGDVAFICEVKQAGVFTISGLEDVQMAHCLTSQCPNML
FPYARELVSNLVNRGTFPALNLSPVNFDALFVEYMNRQQAENAE
Ligand information
>1ozb Chain I (length=24) Species: 727 (Haemophilus influenzae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IGRNEPCPCGSGKKYKHCHGSRVA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ozb Structural determinants of SecB recognition by SecA in bacterial protein translocation
Resolution2.8 Å
Binding residue
(original residue number in PDB)		D27 V28 S29 E31 N34 E72 E86
Binding residue
(residue number reindexed from 1)		D12 V13 S14 E16 N19 E57 E71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0051082 unfolded protein binding
Biological Process
GO:0006457 protein folding
GO:0015031 protein transport
GO:0051262 protein tetramerization
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ozb, PDBe:1ozb, PDBj:1ozb
PDBsum1ozb
PubMed14517549
UniProtP44853|SECB_HAEIN Protein-export protein SecB (Gene Name=secB)

[Back to BioLiP]