Structure of PDB 1ow7 Chain A Binding Site BS01

Receptor Information
>1ow7 Chain A (length=134) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLL
ATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQE
YKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ow7 Molecular Recognition of Paxillin LD Motifs by the Focal Adhesion Targeting Domain
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Y925 I936 H1025 K1032
Binding residue
(residue number reindexed from 1)		Y10 I21 H110 K117
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
Gene Ontology
Molecular Function
GO:0004713 protein tyrosine kinase activity
Biological Process
GO:0006468 protein phosphorylation
GO:0007172 signal complex assembly
Cellular Component
GO:0005925 focal adhesion

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ow7, PDBe:1ow7, PDBj:1ow7
PDBsum1ow7
PubMed14527389
UniProtQ05397|FAK1_HUMAN Focal adhesion kinase 1 (Gene Name=PTK2)

[Back to BioLiP]