Structure of PDB 1ou8 Chain A Binding Site BS01

Receptor Information
>1ou8 Chain A (length=106) Species: 727 (Haemophilus influenzae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSPKRPYLLRAYYDWLVDNSFTPYLVVDATYLGVNVPVEYVKDGQIVLNL
SASATGNLQLTNDFIQFNARFKGVSRELYIPMGAALAIYARENGDGVMFE
PEEIYD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ou8 Structure of a delivery protein for an AAA+ protease in complex with a peptide degradation tag
Resolution1.6 Å
Binding residue
(original residue number in PDB)
Y28 Y44 I50 V51 L52 N53 S57 A58 T59 G60 N72 A73 R74 F75 K76 G77 S79 R95
Binding residue
(residue number reindexed from 1)
Y24 Y40 I46 V47 L48 N49 S53 A54 T55 G56 N68 A69 R70 F71 K72 G73 S75 R91
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1ou8, PDBe:1ou8, PDBj:1ou8
PDBsum1ou8
PubMed14536076
UniProtP45206|SSPB_HAEIN Stringent starvation protein B homolog (Gene Name=sspB)

[Back to BioLiP]