Structure of PDB 1osv Chain A Binding Site BS01

Receptor Information

>1osv Chain A (length=229) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AELTVDQQTLLDYIMDSYSKQRMPQEITNKILKEEFSAEENFLILTEMAT
SHVQILVEFTKRLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPA
GHADLLEERIRKSGISDEYITPMFSFYKSVGELKMTQEEYALLTAIVILS
PDRQYIKDREAVEKLQEPLLDVLQKLCKIYQPENPQHFACLLGRLTELRT
FNHHHAEMLMSWRVNDHKFTPLLCEIWDV

Ligand information

>1osv Chain C (length=12) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ENALLRYLLDKD

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1osv Structural Basis for Bile Acid Binding and Activation of the Nuclear Receptor FXR
Resolution	2.5 Å
Binding residue (original residue number in PDB)	E297 H310 I314 K318 P460 L461 E464
Binding residue (residue number reindexed from 1)	E58 H71 I75 K79 P221 L222 E225

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity
GO:0032052	bile acid binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0038183	bile acid signaling pathway

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1osv, PDBe:1osv, PDBj:1osv
PDBsum	1osv
PubMed	12718893
UniProt	Q62735\|NR1H4_RAT Bile acid receptor (Gene Name=Nr1h4)

[Back to BioLiP]