Structure of PDB 1osb Chain A Binding Site BS01

Receptor Information
>1osb Chain A (length=287) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLSHMVLTRQDIGRAASYYEDGADGDASEWQGKGAEELGLSGEVDSKRFR
ELLAGNIGEGHRIMRSATRQDSKERIGLDLTFSAPKSVSLQALVAGDAEI
IKAHDRAVARTLEQAEARAQARQKIQGKTRIETTGNLVIGKFRHETSRER
DPQLHTHAVILNMTKRSDGQWRALKNDEIVKATRYLGAVYNAELAHELQK
LGYQLRYGKDGNFDLAHIDRQQIEGFSKRTEQIAEWYAARGLDPNSVSLE
QKQAAKVLSRAKKTSVDREALRAEWQATAKELGIDFS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1osb Recognition and processing of the origin of transfer DNA by conjugative relaxase TrwC.
Resolution2.65 Å
Binding residue
(original residue number in PDB)
M1 S3 H4 S72 A73 T74 R75 Q76 D77 K79 R81 S89 A90 P91 K92 R128 K130 Q132 T152 R154 Q159 H161 H163 R172 R178 A179 N182 D183 K215 N218 R226 S233 R235 T236 I239 L255 K258 K262 R266
Binding residue
(residue number reindexed from 1)
M1 S3 H4 S66 A67 T68 R69 Q70 D71 K73 R75 S83 A84 P85 K86 R122 K124 Q126 T146 R148 Q153 H155 H157 R166 R172 A173 N176 D177 K209 N212 R220 S227 R229 T230 I233 L249 K252 K256 R260
Binding affinityPDBbind-CN: Kd=70nM
Enzymatic activity
Enzyme Commision number ?
External links