Structure of PDB 1oqp Chain A Binding Site BS01

Receptor Information
>1oqp Chain A (length=77) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSGERDSREEILKAFRLFDDDNSGTITIKDLRRVAKELGENLTEEELQEM
IAEADRNDDNEIDEDEFIRIMKKTSLF
Ligand information
>1oqp Chain B (length=19) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KKRELIESKWHRLLFHDKK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1oqp Unique Features in the C-terminal Domain Provide Caltractin with Target Specificity
ResolutionN/A
Binding residue
(original residue number in PDB)
F110 L123 L130 E132 E141 M142 E145 I162 M163 K165 L168
Binding residue
(residue number reindexed from 1)
F18 L31 L38 E40 E49 M50 E53 I70 M71 K73 L76
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding

View graph for
Molecular Function
External links
PDB RCSB:1oqp, PDBe:1oqp, PDBj:1oqp
PDBsum1oqp
PubMed12842464
UniProtP05434|CATR_CHLRE Caltractin

[Back to BioLiP]