Structure of PDB 1opi Chain A Binding Site BS01

Receptor Information
>1opi Chain A (length=104) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPV
DGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHR
RDFW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1opi Structural basis for the molecular recognition between human splicing factors U2AF65 and SF1/mBBP
ResolutionN/A
Binding residue
(original residue number in PDB)		E397 E400 D401 E405 L449 R452 K453 F454 V459
Binding residue
(residue number reindexed from 1)		E26 E29 D30 E34 L78 R81 K82 F83 V88
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:1opi, PDBe:1opi, PDBj:1opi
PDBsum1opi
PubMed12718882
UniProtP26368|U2AF2_HUMAN Splicing factor U2AF 65 kDa subunit (Gene Name=U2AF2)

[Back to BioLiP]