Structure of PDB 1oo4 Chain A Binding Site BS01

Receptor Information
>1oo4 Chain A (length=111) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTL
TLRKGGNNKSIKIFHRDGKYGFSDSLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1oo4 Nuclear magnetic resonance structure of the P395S mutant of the N-SH2 domain of the p85 subunit of PI3 kinase: an SH2 domain with altered specificity
ResolutionN/A
Binding residue
(original residue number in PDB)		R20 R38 A40 S41 T42 R53 N58 K59 S60 K62 V81 I85 P98
Binding residue
(residue number reindexed from 1)		R20 R38 A40 S41 T42 R53 N58 K59 S60 K62 V81 I85 P98
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1oo4, PDBe:1oo4, PDBj:1oo4
PDBsum1oo4
PubMed14503862
UniProtP23727|P85A_BOVIN Phosphatidylinositol 3-kinase regulatory subunit alpha (Gene Name=PIK3R1)

[Back to BioLiP]